Important: To support fast and efficient fulfillment, Southern Aminos may maintain inventory from multiple active batches of the same product. Orders are fulfilled using the available inventory at the time of processing; therefore, we cannot guarantee or accommodate requests for a specific batch. Please be assured that every active batch has undergone thorough testing and has passed all required quality-control standards before being released for sale.
Current LL-37 Certificate of Analysis
These are the latest COA’s for current selling products
| Peptide | COA Date | Batch | Cap/Crimp | Conformity Mass Testing | Conformity Purity Testing | Endotoxin | COA Link |
|---|---|---|---|---|---|---|---|
| LL-37 5MG | 1/17/2026 | LL050126A | CLEAR/SILVER | Vial 1: 8.15mg Vial 2: 7.69mg Vial 3: 7.16mg |
Vial 1: 99.81% Vial 2: 99.82% Vial 3: 99.85% |
NONE DETECTED | LL-37 LL050126A 5mg |
Showing 1 to 1 of 1 entry
LL-37 5MG
Available to order right here on Southern Aminos. Formulated using strict quality standards with batch-specific testing for purity and consistency.
Key Features
High purity (verified by batch testing)
Third-Party Testing
Prepared in controlled laboratory conditions
Lyophilized Format:Lyophilized format suitable for standard laboratory reconstitution procedures
| Product Name | LL-37 | |
| CAS Number | 22150-29-6 | |
| Sequence | [LL-37, 37 aa] | |
| Molecular Formula | C₁₉₈H₃₁₇N₅₅O₅₀ | |
| Molecular Weight | 4493.26 g/mol | |
| Purity | ≥98% (HPLC validated) | |
| Synthesis Method | Solid-phase peptide synthesis (SPPS) | |
| Format | Lyophilized powder | |
| Appearance | White to off-white crystalline powder | |
| Solubility | Soluble in sterile water or PBS | |
| Stability & Storage | −20°C for 24 months; post-reconstitution: 4°C ≤7 days | −20°C ≤3 months |
| Shipping Conditions | Ambient temperature; refrigerate upon receipt | |
| Regulatory Status | For research use only; non-therapeutic grade |
The products offered by Coast Peptides are intended strictly for laboratory research purposes only and are sold exclusively to qualified professionals, institutions, and entities. These products are not for human consumption, veterinary use, or any other application involving living organisms, including but not limited to diagnostic, therapeutic, or recreational purposes.
By purchasing this product, you confirm that:
- You are a qualified professional or entity with the necessary knowledge, training, and facilities to handle chemical reagents safely and appropriately.
- You will use this product in full compliance with all applicable local, state, and federal laws and regulations.
Prohibited Uses:
- This product is not to be used as an active pharmaceutical ingredient (API) in compounding or manufacturing drugs for human or veterinary use.
- It is strictly prohibited to use this product for administration to humans or animals under any circumstances.
- Coast Peptides does not condone or permit the use of its products for the development, testing, or production of illegal substances.
Regulatory Compliance:
Coast Peptides does not claim that this product is approved by the U.S. Food and Drug Administration (FDA) for any purpose. The statements regarding this product have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
Liability Statement:
The buyer assumes full responsibility for ensuring the safe handling, storage, and use of this product. Coast Peptides is not liable for any damages, direct or indirect, resulting from improper handling, storage, or unauthorized use of this product. Furthermore, Coast Peptides reserves the right to refuse sales to any individual or entity suspected of misusing its products.
If you have questions about the safe and lawful use of this product, consult a qualified professional with expertise in laboratory research. By proceeding with this purchase, you agree to these terms and conditions.
| Weight | 1 oz |
|---|---|
| MG |
5mg |
The products available here are designed exclusively for research and laboratory use. They are not approved for human or animal consumption. These items are not classified as medicines or drugs and have not been evaluated or approved by the U.S. Food and Drug Administration (FDA) for the diagnosis, treatment, cure, or prevention of any disease or medical condition. Not for clinical, diagnostic, or therapeutic use. The product page photos are representative images only and are not intended to reflect the exact batch specifications for every shipment. We are a large peptide business and run multiple batches per product, all current batches are listed on the product page, we are unable to provide batch specific requests, and there should be no expectation that you will receive any current specific batch. Product images are for illustrative purposes only. Actual labels, packaging, and product color may vary.

